SCOP 1.73: Domain d2b4ch2: 2b4c H:114-212

Lineage for d2b4ch2 (2b4c H:114-212)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2b4ch2: 2b4c H:114-212 [127823]
   Other proteins in same PDB: d2b4cc1, d2b4cc2, d2b4ch1, d2b4cl1, d2b4cl2
   automatically matched to d1q1jh2
   complexed with fuc, nag, ndg, so4, xyl; mutant

Details for d2b4ch2

PDB Entry: 2b4c, 3.3 Å

PDB Description: crystal structure of hiv-1 jr-fl gp120 core protein containing the third variable region (v3) complexed with cd4 and the x5 antibody

PDB Compounds: (H:) anti-HIV-1 gp120 immunoglobulin X5 heavy chain

SCOP Domain Sequences for d2b4ch2:

Sequence; same for both SEQRES and ATOM records:

>d2b4ch2 b.1.1.2 (H:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkve

Timeline for d2b4ch2:

• d2b4ch2 is new in SCOP 1.73
  
• d2b4ch2 appears in SCOP 1.75
  
• d2b4ch2 appears in the current release, SCOPe 2.08