Lineage for d2b4ch1 (2b4c H:4-113)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1755902Species Human (Homo sapiens), cluster 4 [TaxId:9606] [101505] (4 PDB entries)
  8. 1755909Domain d2b4ch1: 2b4c H:4-113 [127822]
    Other proteins in same PDB: d2b4cc1, d2b4cc2, d2b4cg1, d2b4ch2, d2b4cl1, d2b4cl2
    automatically matched to d1q1jh1
    complexed with nag, ndg, so4, xyl

Details for d2b4ch1

PDB Entry: 2b4c (more details), 3.3 Å

PDB Description: crystal structure of hiv-1 jr-fl gp120 core protein containing the third variable region (v3) complexed with cd4 and the x5 antibody
PDB Compounds: (H:) anti-HIV-1 gp120 immunoglobulin X5 heavy chain

SCOPe Domain Sequences for d2b4ch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4ch1 b.1.1.1 (H:4-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
leqsgaevkkpgssvqvsckasggtfsmygfnwvrqapghglewmggiipifgtsnyaqk
frgrvtftadqatstaymeltnlrsddtavyycardfgpdwedgdsydgsgrgffdfwgq
gtlvtvss

SCOPe Domain Coordinates for d2b4ch1:

Click to download the PDB-style file with coordinates for d2b4ch1.
(The format of our PDB-style files is described here.)

Timeline for d2b4ch1: