Lineage for d2b4cc2 (2b4c C:98-175)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764328Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 1764338Protein CD4 C2-set domains [49149] (2 species)
  7. 1764339Species Human (Homo sapiens) [TaxId:9606] [49150] (31 PDB entries)
  8. 1764368Domain d2b4cc2: 2b4c C:98-175 [127821]
    Other proteins in same PDB: d2b4cc1, d2b4cg1, d2b4ch1, d2b4ch2, d2b4cl1, d2b4cl2
    automatically matched to d1g9mc2
    complexed with nag, ndg, so4, xyl

Details for d2b4cc2

PDB Entry: 2b4c (more details), 3.3 Å

PDB Description: crystal structure of hiv-1 jr-fl gp120 core protein containing the third variable region (v3) complexed with cd4 and the x5 antibody
PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2b4cc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4cc2 b.1.1.3 (C:98-175) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidiv

SCOPe Domain Coordinates for d2b4cc2:

Click to download the PDB-style file with coordinates for d2b4cc2.
(The format of our PDB-style files is described here.)

Timeline for d2b4cc2: