SCOP 1.73: Domain d2b4cc1: 2b4c C:1-97

Lineage for d2b4cc1 (2b4c C:1-97)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (25 PDB entries)

8. Domain d2b4cc1: 2b4c C:1-97 [127820]
   Other proteins in same PDB: d2b4cc2, d2b4ch1, d2b4ch2, d2b4cl1, d2b4cl2
   automatically matched to d1cdi_1
   complexed with fuc, nag, ndg, so4, xyl; mutant

Details for d2b4cc1

PDB Entry: 2b4c, 3.3 Å

PDB Description: crystal structure of hiv-1 jr-fl gp120 core protein containing the third variable region (v3) complexed with cd4 and the x5 antibody

PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d2b4cc1:

Sequence; same for both SEQRES and ATOM records:

>d2b4cc1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d2b4cc1:

• d2b4cc1 is new in SCOP 1.73
  
• d2b4cc1 appears in SCOP 1.75
  
• d2b4cc1 appears in the current release, SCOPe 2.08