SCOP 1.73: Domain d2b4aa1: 2b4a A:2-119

Lineage for d2b4aa1 (2b4a A:2-119)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein Hypothetical protein BH3024 [142029] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [142030] (1 PDB entry)

8. Domain d2b4aa1: 2b4a A:2-119 [127817]
   complexed with edo

Details for d2b4aa1

PDB Entry: 2b4a, 2.42 Å

PDB Description: Crystal structure of a response regulator receiver domain protein (bh3024) from bacillus halodurans c-125 at 2.42 A resolution

PDB Compounds: (A:) bh3024

SCOP Domain Sequences for d2b4aa1:

Sequence, based on SEQRES records:

>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]}
qpfrvtlvedepshatliqyhlnqlgaevtvhpsgsaffqhrsqlstcdllivsdqlvdl
sifslldivkeqtkqpsvlilttgrheliessehnlsylqkpfaiselraaidyhkps

Sequence, based on observed residues (ATOM records):

>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]}
qpfrvtlvedepshatliqyhlnqlgaevtvhpsgsaffqhrsqlstcdllivsdqlvdl
sifslldivkeqtkqpsvlilttgrliessehnlsylqkpfaiselraaidyhkps

Timeline for d2b4aa1:

• d2b4aa1 is new in SCOP 1.73
  
• d2b4aa1 appears in SCOP 1.75
  
• d2b4aa1 appears in the current release, SCOPe 2.08