Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (7 families) |
Family c.23.1.1: CheY-related [52173] (25 proteins) |
Protein Hypothetical protein BH3024 [142029] (1 species) |
Species Bacillus halodurans [TaxId:86665] [142030] (1 PDB entry) |
Domain d2b4aa1: 2b4a A:2-119 [127817] complexed with edo |
PDB Entry: 2b4a (more details), 2.42 Å
SCOP Domain Sequences for d2b4aa1:
Sequence, based on SEQRES records: (download)
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} qpfrvtlvedepshatliqyhlnqlgaevtvhpsgsaffqhrsqlstcdllivsdqlvdl sifslldivkeqtkqpsvlilttgrheliessehnlsylqkpfaiselraaidyhkps
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} qpfrvtlvedepshatliqyhlnqlgaevtvhpsgsaffqhrsqlstcdllivsdqlvdl sifslldivkeqtkqpsvlilttgrliessehnlsylqkpfaiselraaidyhkps
Timeline for d2b4aa1: