![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) ![]() |
![]() | Family c.66.1.30: N5-glutamine methyltransferase, HemK [89743] (2 proteins) |
![]() | Protein N5-glutamine methyltransferase, HemK [89744] (2 species) contains an N-terminal alpha helical subdomain; res. 13-84 |
![]() | Species Escherichia coli [TaxId:562] [110666] (2 PDB entries) Uniprot P37186 |
![]() | Domain d2b3ta1: 2b3t A:2-275 [127796] Other proteins in same PDB: d2b3tb1 automatically matched to d1t43a_ complexed with sah |
PDB Entry: 2b3t (more details), 3.1 Å
SCOPe Domain Sequences for d2b3ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} eyqhwlreaisqlqasesprrdaeillehvtgrgrtfilafgetqltdeqcqqldalltr rrdgepiahltgvrefwslplfvspatliprpdteclveqalarlpeqpcrildlgtgtg aialalaserpdceiiavdrmpdavslaqrnaqhlaiknihilqsdwfsalagqqfamiv snppyideqdphlqqgdvrfepltalvaadsgmadivhiieqsrnalvsggflllehgwq qgeavrqafilagyhdvetcrdygdnervtlgry
Timeline for d2b3ta1: