SCOP 1.75: Domain d2b3nb1: 2b3n B:6-159

Lineage for d2b3nb1 (2b3n B:6-159)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.4: MaoC-like [82636] (6 proteins)

6. Protein Hypothetical protein AF1124 [143171] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [143172] (2 PDB entries)
   Uniprot O29141 6-159

8. Domain d2b3nb1: 2b3n B:6-159 [127793]
   automatically matched to 2B3M A:6-159
   complexed with 144, po4

Details for d2b3nb1

PDB Entry: 2b3n, 1.25 Å

PDB Description: Crystal structure of protein AF1124 from Archaeoglobus fulgidus

PDB Compounds: (B:) hypothetical protein AF1124

SCOP Domain Sequences for d2b3nb1:

Sequence; same for both SEQRES and ATOM records:

>d2b3nb1 d.38.1.4 (B:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
vkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdlnp
vhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvrve
gvvsgveknrytidvkcytgdkvvaegvvkvliw

Timeline for d2b3nb1:

• d2b3nb1 first appeared in SCOP 1.73
  
• d2b3nb1 does not appear in SCOPe 2.01