Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) |
Family d.38.1.4: MaoC-like [82636] (6 proteins) |
Protein Hypothetical protein AF1124 [143171] (1 species) |
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [143172] (2 PDB entries) Uniprot O29141 6-159 |
Domain d2b3na1: 2b3n A:6-159 [127792] automatically matched to 2B3M A:6-159 complexed with 144, po4 |
PDB Entry: 2b3n (more details), 1.25 Å
SCOP Domain Sequences for d2b3na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} vkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdlnp vhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvrve gvvsgveknrytidvkcytgdkvvaegvvkvliw
Timeline for d2b3na1: