Lineage for d2b2xl2 (2b2x L:107-215)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656289Domain d2b2xl2: 2b2x L:107-215 [127751]
    Other proteins in same PDB: d2b2xa1, d2b2xb1, d2b2xl1, d2b2xm1
    automatically matched to d1dqdl2
    complexed with mg; mutant

Details for d2b2xl2

PDB Entry: 2b2x (more details), 2.2 Å

PDB Description: vla1 rdeltah i-domain complexed with a quadruple mutant of the aqc2 fab
PDB Compounds: (L:) Antibody AQC2 Fab

SCOP Domain Sequences for d2b2xl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b2xl2 b.1.1.2 (L:107-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d2b2xl2:

Click to download the PDB-style file with coordinates for d2b2xl2.
(The format of our PDB-style files is described here.)

Timeline for d2b2xl2: