SCOP 1.73: Domain d2b2xl1: 2b2x L:2-106

Lineage for d2b2xl1 (2b2x L:2-106)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (40 PDB entries)

8. Domain d2b2xl1: 2b2x L:2-106 [127750]
   Other proteins in same PDB: d2b2xa1, d2b2xb1, d2b2xl2, d2b2xm2
   automatically matched to d1dqdl1
   complexed with mg; mutant

Details for d2b2xl1

PDB Entry: 2b2x, 2.2 Å

PDB Description: vla1 rdeltah i-domain complexed with a quadruple mutant of the aqc2 fab

PDB Compounds: (L:) Antibody AQC2 Fab

SCOP Domain Sequences for d2b2xl1:

Sequence; same for both SEQRES and ATOM records:

>d2b2xl1 b.1.1.1 (L:2-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
iqltqspsslsasvgdrvtitcsassqvnhmfwyqqkpgkapkpwiyltsylasgvpsrf
sgsgsgtdytltisslqpedfatyycqqwsgnpwtfgqgtkveik

Timeline for d2b2xl1:

• d2b2xl1 is new in SCOP 1.73
  
• d2b2xl1 appears in SCOP 1.75
  
• d2b2xl1 appears in the current release, SCOPe 2.08