Lineage for d2b2xa1 (2b2x A:146-336)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704292Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 704293Superfamily c.62.1: vWA-like [53300] (5 families) (S)
  5. 704294Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)
  6. 704324Protein Integrin alpha1-beta1 [53310] (2 species)
  7. 704331Species Rat (Rattus norvegicus) [TaxId:10116] [53312] (3 PDB entries)
  8. 704332Domain d2b2xa1: 2b2x A:146-336 [127748]
    Other proteins in same PDB: d2b2xl1, d2b2xl2, d2b2xm1, d2b2xm2
    automatically matched to d1mhpa_
    complexed with mg; mutant

Details for d2b2xa1

PDB Entry: 2b2x (more details), 2.2 Å

PDB Description: vla1 rdeltah i-domain complexed with a quadruple mutant of the aqc2 fab
PDB Compounds: (A:) integrin alpha-1

SCOP Domain Sequences for d2b2xa1:

Sequence, based on SEQRES records: (download)

>d2b2xa1 c.62.1.1 (A:146-336) Integrin alpha1-beta1 {Rat (Rattus norvegicus) [TaxId: 10116]}
qldivivldgsnsiypwesviaflndllkrmdigpkqtqvgivqygenvthefnlnkyss
teevlvaankivqrggrqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdnyr
lkqviqdcedeniqrfsiailghynrgnlstekfveeiksiaseptekhffnvsdelalv
tivkalgerif

Sequence, based on observed residues (ATOM records): (download)

>d2b2xa1 c.62.1.1 (A:146-336) Integrin alpha1-beta1 {Rat (Rattus norvegicus) [TaxId: 10116]}
qldivivldgsnsiypwesviaflndllkrmdigpkqtqvgivqygenvthefnlnkyss
teevlvaankivqrggrqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdnyr
lkqviqdcedeniqrfsiailghynlstekfveeiksiaseptekhffnvsdelalvtiv
kalgerif

SCOP Domain Coordinates for d2b2xa1:

Click to download the PDB-style file with coordinates for d2b2xa1.
(The format of our PDB-style files is described here.)

Timeline for d2b2xa1: