Lineage for d2b2qa1 (2b2q A:35-440)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005634Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
    duplication: tandem repeat of two CCP-like domains
  6. 2005635Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 2005636Species Burkholderia pseudomallei [TaxId:28450] [89093] (21 PDB entries)
    Uniprot P13029 Q939D2 35-748
  8. 2005681Domain d2b2qa1: 2b2q A:35-440 [127716]
    automated match to d1mwva1
    complexed with hem, na, peo, trs

Details for d2b2qa1

PDB Entry: 2b2q (more details), 2.05 Å

PDB Description: crystal structure of native catalase-peroxidase katg at ph7.5
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d2b2qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b2qa1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp

SCOPe Domain Coordinates for d2b2qa1:

Click to download the PDB-style file with coordinates for d2b2qa1.
(The format of our PDB-style files is described here.)

Timeline for d2b2qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b2qa2