Lineage for d2b29a_ (2b29 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789537Protein automated matches [190206] (10 species)
    not a true protein
  7. 2789550Species Human (Homo sapiens) [TaxId:9606] [186959] (27 PDB entries)
  8. 2789565Domain d2b29a_: 2b29 A: [127705]
    automated match to d1ewia_

Details for d2b29a_

PDB Entry: 2b29 (more details), 1.6 Å

PDB Description: N-terminal domain of the RPA70 subunit of human replication protein A.
PDB Compounds: (A:) Replication protein A 70 kDa DNA-binding subunit

SCOPe Domain Sequences for d2b29a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b29a_ b.40.4.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqlsegaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlatql
nplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne

SCOPe Domain Coordinates for d2b29a_:

Click to download the PDB-style file with coordinates for d2b29a_.
(The format of our PDB-style files is described here.)

Timeline for d2b29a_: