Lineage for d2b24e2 (2b24 E:163-440)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1218105Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1218323Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1218397Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 1218412Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (2 species)
  7. 1218432Species Rhodococcus sp. ncimb12038 [TaxId:92694] [143822] (2 PDB entries)
    Uniprot Q9X3R9 163-441
  8. 1218438Domain d2b24e2: 2b24 E:163-440 [127697]
    Other proteins in same PDB: d2b24a1, d2b24b1, d2b24c1, d2b24d1, d2b24e1, d2b24f1
    automatically matched to 2B1X A:163-441
    complexed with fe, fes, ind

Details for d2b24e2

PDB Entry: 2b24 (more details), 3 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp. bound to indole
PDB Compounds: (E:) naphthalene dioxygenase large subunit

SCOPe Domain Sequences for d2b24e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b24e2 d.129.3.3 (E:163-440) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]}
adsledylgdlkfyldivldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthr
smvelglappdpqfalygehihtghghglgiigpppgmplpefmglpeniveelerrltp
eqveifrptafihgtvfpnlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflv
ekdapdwfkdesyksylrtfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvl
epdpnwtgpgeaypldyaeanqrnfleywmqlmlaesp

SCOPe Domain Coordinates for d2b24e2:

Click to download the PDB-style file with coordinates for d2b24e2.
(The format of our PDB-style files is described here.)

Timeline for d2b24e2: