Lineage for d2b24d1 (2b24 D:515-679)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020265Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1020277Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (3 species)
  7. 1020298Species Rhodococcus sp. ncimb12038 [TaxId:92694] [142996] (2 PDB entries)
    Uniprot Q7BSK6 6-172
  8. 1020301Domain d2b24d1: 2b24 D:515-679 [127695]
    Other proteins in same PDB: d2b24a1, d2b24a2, d2b24c1, d2b24c2, d2b24e1, d2b24e2
    automatically matched to 2B1X B:513-679
    complexed with fe, fes, ind

Details for d2b24d1

PDB Entry: 2b24 (more details), 3 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp. bound to indole
PDB Compounds: (D:) naphthalene dioxygenase small subunit

SCOPe Domain Sequences for d2b24d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b24d1 d.17.4.4 (D:515-679) Naphthalene 1,2-dioxygenase beta subunit {Rhodococcus sp. ncimb12038 [TaxId: 92694]}
sdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdvvegmthm
dddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnlllyrtrgd
vatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim

SCOPe Domain Coordinates for d2b24d1:

Click to download the PDB-style file with coordinates for d2b24d1.
(The format of our PDB-style files is described here.)

Timeline for d2b24d1: