SCOPe 2.08: Domain d2b24a2: 2b24 A:163-440

Lineage for d2b24a2 (2b24 A:163-440)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species)

7. Species Rhodococcus sp. [TaxId:92694] [255043] (1 PDB entry)

8. Domain d2b24a2: 2b24 A:163-440 [127691]
   Other proteins in same PDB: d2b24a1, d2b24b_, d2b24c1, d2b24d_, d2b24e1, d2b24f_
   automated match to d2b1xa2
   complexed with fe, fes, ind

Details for d2b24a2

PDB Entry: 2b24, 3 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp. bound to indole

PDB Compounds: (A:) naphthalene dioxygenase large subunit

SCOPe Domain Sequences for d2b24a2:

Sequence; same for both SEQRES and ATOM records:

>d2b24a2 d.129.3.3 (A:163-440) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Rhodococcus sp. [TaxId: 92694]}
adsledylgdlkfyldivldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthr
smvelglappdpqfalygehihtghghglgiigpppgmplpefmglpeniveelerrltp
eqveifrptafihgtvfpnlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflv
ekdapdwfkdesyksylrtfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvl
epdpnwtgpgeaypldyaeanqrnfleywmqlmlaesp

Timeline for d2b24a2:

• d2b24a2 first appeared in SCOP 1.73
  
• d2b24a2 appears in SCOPe 2.07