![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
![]() | Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species) |
![]() | Domain d2b24a2: 2b24 A:163-440 [127691] Other proteins in same PDB: d2b24a1, d2b24b_, d2b24c1, d2b24d_, d2b24e1, d2b24f_ automated match to d2b1xa2 complexed with fe, fes, ind |
PDB Entry: 2b24 (more details), 3 Å
SCOPe Domain Sequences for d2b24a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b24a2 d.129.3.3 (A:163-440) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Rhodococcus sp. [TaxId: 92694]} adsledylgdlkfyldivldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthr smvelglappdpqfalygehihtghghglgiigpppgmplpefmglpeniveelerrltp eqveifrptafihgtvfpnlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflv ekdapdwfkdesyksylrtfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvl epdpnwtgpgeaypldyaeanqrnfleywmqlmlaesp
Timeline for d2b24a2: