Lineage for d2b1xe1 (2b1x E:1-162)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664899Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 664900Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 664968Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 664983Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (2 species)
  7. 665003Species Rhodococcus sp. ncimb12038 [TaxId:92694] [141177] (2 PDB entries)
  8. 665006Domain d2b1xe1: 2b1x E:1-162 [127681]
    Other proteins in same PDB: d2b1xa2, d2b1xb1, d2b1xc2, d2b1xd1, d2b1xe2, d2b1xf1
    automatically matched to 2B1X A:1-162
    complexed with fe, fes, mpd

Details for d2b1xe1

PDB Entry: 2b1x (more details), 2 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp.
PDB Compounds: (E:) naphthalene dioxygenase large subunit

SCOP Domain Sequences for d2b1xe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b1xe1 b.33.1.2 (E:1-162) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]}
mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldph

SCOP Domain Coordinates for d2b1xe1:

Click to download the PDB-style file with coordinates for d2b1xe1.
(The format of our PDB-style files is described here.)

Timeline for d2b1xe1: