Lineage for d2b1xc2 (2b1x C:163-441)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872733Superfamily d.129.3: Bet v1-like [55961] (10 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 872794Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 872809Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (2 species)
  7. 872829Species Rhodococcus sp. ncimb12038 [TaxId:92694] [143822] (2 PDB entries)
    Uniprot Q9X3R9 163-441
  8. 872831Domain d2b1xc2: 2b1x C:163-441 [127679]
    Other proteins in same PDB: d2b1xa1, d2b1xb1, d2b1xc1, d2b1xd1, d2b1xe1, d2b1xf1
    automatically matched to 2B1X A:163-441
    complexed with fe, fes, mpd

Details for d2b1xc2

PDB Entry: 2b1x (more details), 2 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp.
PDB Compounds: (C:) naphthalene dioxygenase large subunit

SCOP Domain Sequences for d2b1xc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b1xc2 d.129.3.3 (C:163-441) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]}
adsledylgdlkfyldivldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthr
smvelglappdpqfalygehihtghghglgiigpppgmplpefmglpeniveelerrltp
eqveifrptafihgtvfpnlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflv
ekdapdwfkdesyksylrtfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvl
epdpnwtgpgeaypldyaeanqrnfleywmqlmlaespl

SCOP Domain Coordinates for d2b1xc2:

Click to download the PDB-style file with coordinates for d2b1xc2.
(The format of our PDB-style files is described here.)

Timeline for d2b1xc2: