SCOP 1.75: Domain d2b1xc1: 2b1x C:1-162

Lineage for d2b1xc1 (2b1x C:1-162)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (3 families)

5. Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (2 species)

7. Species Rhodococcus sp. ncimb12038 [TaxId:92694] [141177] (2 PDB entries)
   Uniprot Q9X3R9 1-162

8. Domain d2b1xc1: 2b1x C:1-162 [127678]
   Other proteins in same PDB: d2b1xa2, d2b1xb1, d2b1xc2, d2b1xd1, d2b1xe2, d2b1xf1
   automatically matched to 2B1X A:1-162
   complexed with fe, fes, mpd

Details for d2b1xc1

PDB Entry: 2b1x, 2 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp.

PDB Compounds: (C:) naphthalene dioxygenase large subunit

SCOP Domain Sequences for d2b1xc1:

Sequence; same for both SEQRES and ATOM records:

>d2b1xc1 b.33.1.2 (C:1-162) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]}
mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldph

Timeline for d2b1xc1:

• d2b1xc1 first appeared in SCOP 1.73
  
• d2b1xc1 appears in SCOPe 2.01
  
• d2b1xc1 appears in the current release, SCOPe 2.08