Class b: All beta proteins [48724] (174 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (3 families) |
Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (2 species) |
Species Rhodococcus sp. ncimb12038 [TaxId:92694] [141177] (2 PDB entries) Uniprot Q9X3R9 1-162 |
Domain d2b1xc1: 2b1x C:1-162 [127678] Other proteins in same PDB: d2b1xa2, d2b1xb1, d2b1xc2, d2b1xd1, d2b1xe2, d2b1xf1 automatically matched to 2B1X A:1-162 complexed with fe, fes, mpd |
PDB Entry: 2b1x (more details), 2 Å
SCOP Domain Sequences for d2b1xc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b1xc1 b.33.1.2 (C:1-162) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]} mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldph
Timeline for d2b1xc1: