SCOPe 2.02: Domain d2b1hh1: 2b1h H:1-113

Lineage for d2b1hh1 (2b1h H:1-113)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (67 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d2b1hh1: 2b1h H:1-113 [127668]
   Other proteins in same PDB: d2b1hh2
   automatically matched to d1fgvh_

Details for d2b1hh1

PDB Entry: 2b1h, 2 Å

PDB Description: crystal structure analysis of anti-hiv-1 v3 fab 2219 in complex with ug29 peptide

PDB Compounds: (H:) Fab 2219, heavy chain

SCOPe Domain Sequences for d2b1hh1:

Sequence; same for both SEQRES and ATOM records:

>d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
eiqleqsgaevkksgeslkiscqtsgysfsdywigwvrqmpgkglewmgifypgdsdsry
spsfegqvtmsadrstntahlqwsslkpsdtalyycarlggdyedsgadafdfwgqgtlv
tvss

Timeline for d2b1hh1:

• d2b1hh1 first appeared in SCOP 1.73
  
• d2b1hh1 appears in SCOPe 2.01
  
• d2b1hh1 appears in SCOPe 2.03
  
• d2b1hh1 appears in the current release, SCOPe 2.08