SCOPe 2.04: Domain d2b12a_: 2b12 A:

Lineage for d2b12a_ (2b12 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (170 PDB entries)
   Uniprot P00431

8. Domain d2b12a_: 2b12 A: [127656]
   Other proteins in same PDB: d2b12b1
   automated match to d1s73a_
   complexed with hem, znh

Details for d2b12a_

PDB Entry: 2b12, 3.02 Å

PDB Description: crystal structure of the protein-protein complex between f82y cytochrome c and cytochrome c peroxidase

PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d2b12a_:

Sequence; same for both SEQRES and ATOM records:

>d2b12a_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d2b12a_:

• d2b12a_ first appeared in SCOP 1.73, called d2b12a1
  
• d2b12a_ was called d2b12a1 in SCOPe 2.03
  
• d2b12a_ appears in SCOPe 2.05
  
• d2b12a_ appears in the current release, SCOPe 2.08