Lineage for d2b11c1 (2b11 C:501-794)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644948Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 644949Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 644950Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 644965Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 644966Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (112 PDB entries)
  8. 645070Domain d2b11c1: 2b11 C:501-794 [127655]
    automatically matched to d1koka_
    complexed with hem, znh; mutant

Details for d2b11c1

PDB Entry: 2b11 (more details), 2.3 Å

PDB Description: crystal structure of the protein-protein complex between f82w cytochrome c and cytochrome c peroxidase
PDB Compounds: (C:) Cytochrome c peroxidase, mitochondrial

SCOP Domain Sequences for d2b11c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b11c1 a.93.1.1 (C:501-794) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d2b11c1:

Click to download the PDB-style file with coordinates for d2b11c1.
(The format of our PDB-style files is described here.)

Timeline for d2b11c1: