Lineage for d2b11a1 (2b11 A:1-294)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773241Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 773242Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 773243Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 773259Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 773260Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (123 PDB entries)
    Uniprot P00431
  8. 773377Domain d2b11a1: 2b11 A:1-294 [127654]
    Other proteins in same PDB: d2b11b1, d2b11d1
    automatically matched to d1koka_
    complexed with hem, znh; mutant

Details for d2b11a1

PDB Entry: 2b11 (more details), 2.3 Å

PDB Description: crystal structure of the protein-protein complex between f82w cytochrome c and cytochrome c peroxidase
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOP Domain Sequences for d2b11a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b11a1 a.93.1.1 (A:1-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d2b11a1:

Click to download the PDB-style file with coordinates for d2b11a1.
(The format of our PDB-style files is described here.)

Timeline for d2b11a1: