Lineage for d2b0sh1 (2b0s H:1-113)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510451Species Engineered (including hybrid species) [88562] (68 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 1510478Domain d2b0sh1: 2b0s H:1-113 [127646]
    Other proteins in same PDB: d2b0sh2
    automatically matched to d1fgvh_
    complexed with acy, edo

Details for d2b0sh1

PDB Entry: 2b0s (more details), 2.3 Å

PDB Description: crystal structure analysis of anti-hiv-1 v3 fab 2219 in complex with mn peptide
PDB Compounds: (H:) Fab 2219, heavy chain

SCOPe Domain Sequences for d2b0sh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b0sh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
eiqleqsgaevkksgeslkiscqtsgysfsdywigwvrqmpgkglewmgifypgdsdsry
spsfegqvtmsadrstntahlqwsslkpsdtalyycarlggdyedsgadafdfwgqgtlv
tvss

SCOPe Domain Coordinates for d2b0sh1:

Click to download the PDB-style file with coordinates for d2b0sh1.
(The format of our PDB-style files is described here.)

Timeline for d2b0sh1: