SCOP 1.73: Domain d2b0sh1: 2b0s H:1-113

Lineage for d2b0sh1 (2b0s H:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (66 PDB entries)

8. Domain d2b0sh1: 2b0s H:1-113 [127646]
   Other proteins in same PDB: d2b0sh2
   automatically matched to d1fgvh_
   complexed with acy, edo

Details for d2b0sh1

PDB Entry: 2b0s, 2.3 Å

PDB Description: crystal structure analysis of anti-hiv-1 v3 fab 2219 in complex with mn peptide

PDB Compounds: (H:) Fab 2219, heavy chain

SCOP Domain Sequences for d2b0sh1:

Sequence; same for both SEQRES and ATOM records:

>d2b0sh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
eiqleqsgaevkksgeslkiscqtsgysfsdywigwvrqmpgkglewmgifypgdsdsry
spsfegqvtmsadrstntahlqwsslkpsdtalyycarlggdyedsgadafdfwgqgtlv
tvss

Timeline for d2b0sh1:

• d2b0sh1 is new in SCOP 1.73
  
• d2b0sh1 appears in SCOP 1.75
  
• d2b0sh1 appears in the current release, SCOPe 2.08