SCOP 1.75: Domain d2b03a1: 2b03 A:1-124

Lineage for d2b03a1 (2b03 A:1-124)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Phospholipase A2 [48637] (4 species)

7. Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (19 PDB entries)

8. Domain d2b03a1: 2b03 A:1-124 [127622]
   automatically matched to d1hn4b_
   complexed with ca, tud

Details for d2b03a1

PDB Entry: 2b03, 2.3 Å

PDB Description: Crystal Structure of Porcine Pancreatic Phospholipase A2 in Complex with Taurochenodeoxycholate

PDB Compounds: (A:) phospholipase a2, major isoenzyme

SCOP Domain Sequences for d2b03a1:

Sequence; same for both SEQRES and ATOM records:

>d2b03a1 a.133.1.2 (A:1-124) Phospholipase A2 {Pig (Sus scrofa), pancreas [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

Timeline for d2b03a1:

• d2b03a1 first appeared in SCOP 1.73
  
• d2b03a1 is called d2b03a_ in SCOPe 2.01
  
• d2b03a1 appears in the current release, SCOPe 2.08, called d2b03a_