SCOP 1.75: Domain d2az0b1: 2az0 B:2-71

Lineage for d2az0b1 (2az0 B:2-71)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.8: FHV B2 protein-like [140506] (1 family)

5. Family a.30.8.1: FHV B2 protein-like [140507] (1 protein)

6. Protein B2 [140508] (1 species)

7. Species Flock house virus, FHV [TaxId:12287] [140509] (3 PDB entries)
   Uniprot P68831 1-72! Uniprot P68831 2-71

8. Domain d2az0b1: 2az0 B:2-71 [127579]
   automatically matched to 2AZ0 A:2-71
   complexed with 5bu

Details for d2az0b1

PDB Entry: 2az0, 2.6 Å

PDB Description: Flock House virus B2-dsRNA Complex (P212121)

PDB Compounds: (B:) B2 protein

SCOP Domain Sequences for d2az0b1:

Sequence; same for both SEQRES and ATOM records:

>d2az0b1 a.30.8.1 (B:2-71) B2 {Flock house virus, FHV [TaxId: 12287]}
psklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvsrmvtslle
kpsvvayleg

Timeline for d2az0b1:

• d2az0b1 first appeared in SCOP 1.73
  
• d2az0b1 is called d2az0b_ in SCOPe 2.01
  
• d2az0b1 appears in the current release, SCOPe 2.08, called d2az0b_