Class a: All alpha proteins [46456] (284 folds) |
Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
Superfamily a.30.8: FHV B2 protein-like [140506] (1 family) |
Family a.30.8.1: FHV B2 protein-like [140507] (1 protein) |
Protein B2 [140508] (1 species) |
Species Flock house virus, FHV [TaxId:12287] [140509] (3 PDB entries) Uniprot P68831 1-72! Uniprot P68831 2-71 |
Domain d2az0b1: 2az0 B:2-71 [127579] automatically matched to 2AZ0 A:2-71 complexed with 5bu |
PDB Entry: 2az0 (more details), 2.6 Å
SCOP Domain Sequences for d2az0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2az0b1 a.30.8.1 (B:2-71) B2 {Flock house virus, FHV [TaxId: 12287]} psklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvsrmvtslle kpsvvayleg
Timeline for d2az0b1: