Lineage for d2ayra1 (2ayr A:307-548)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 647893Protein Estrogen receptor alpha [48519] (1 species)
  7. 647894Species Human (Homo sapiens) [TaxId:9606] [48520] (22 PDB entries)
  8. 647901Domain d2ayra1: 2ayr A:307-548 [127569]
    automatically matched to d1qkta_
    complexed with l4g; mutant

Details for d2ayra1

PDB Entry: 2ayr (more details), 1.9 Å

PDB Description: a serm designed for the treatment of uterine leiomyoma with unique tissue specificity for uterus and ovaries in rats
PDB Compounds: (A:) Estrogen receptor

SCOP Domain Sequences for d2ayra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ayra1 a.123.1.1 (A:307-548) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllemlda
hr

SCOP Domain Coordinates for d2ayra1:

Click to download the PDB-style file with coordinates for d2ayra1.
(The format of our PDB-style files is described here.)

Timeline for d2ayra1: