SCOPe 2.06: Domain d2axzb2: 2axz B:67-305

Lineage for d2axzb2 (2axz B:67-305)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)

6. Protein automated matches [254479] (1 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries)

8. Domain d2axzb2: 2axz B:67-305 [127539]
   Other proteins in same PDB: d2axza1, d2axzb1, d2axzc1, d2axzd1
   automated match to d2awia2
   protein/DNA complex

Details for d2axzb2

PDB Entry: 2axz, 3 Å

PDB Description: Crystal structure of PrgX/cCF10 complex

PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2axzb2:

Sequence; same for both SEQRES and ATOM records:

>d2axzb2 a.118.8.4 (B:67-305) automated matches {Enterococcus faecalis [TaxId: 1351]}
mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie
vptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdy
dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfl
tdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyvai

Timeline for d2axzb2:

• d2axzb2 first appeared in SCOP 1.73
  
• d2axzb2 appears in SCOPe 2.05
  
• d2axzb2 appears in SCOPe 2.07
  
• d2axzb2 appears in the current release, SCOPe 2.08