SCOP 1.75: Domain d2axvd2: 2axv D:71-301

Lineage for d2axvd2 (2axv D:71-301)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (8 families)

5. Family a.118.8.4: PrgX C-terminal domain-like [140848] (1 protein)

6. Protein PrgX [140849] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [140850] (7 PDB entries)
   Uniprot Q04114 70-287! Uniprot Q04114 71-301

8. Domain d2axvd2: 2axv D:71-301 [127531]
   Other proteins in same PDB: d2axva1, d2axvb1, d2axvc1, d2axvd1
   automatically matched to 2AWI A:71-301
   mutant

Details for d2axvd2

PDB Entry: 2axv, 3 Å

PDB Description: structure of prgx y153c mutant

PDB Compounds: (D:) PrgX

SCOP Domain Sequences for d2axvd2:

Sequence; same for both SEQRES and ATOM records:

>d2axvd2 a.118.8.4 (D:71-301) PrgX {Enterococcus faecalis [TaxId: 1351]}
svnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievptf
nktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgkdydlti
qtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdkn
idsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen

Timeline for d2axvd2:

• d2axvd2 first appeared in SCOP 1.73
  
• d2axvd2 appears in SCOPe 2.01
  
• d2axvd2 appears in the current release, SCOPe 2.08