Lineage for d2axuk1 (2axu K:4-68)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768300Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
    Part of Pfam PF01381
  6. 768301Protein PrgX [140527] (1 species)
    possibly involved in pheromone-inducible conjugation
  7. 768302Species Enterococcus faecalis [TaxId:1351] [140528] (7 PDB entries)
    Uniprot Q04114 1-69! Uniprot Q04114 2-66
  8. 768325Domain d2axuk1: 2axu K:4-68 [127520]
    Other proteins in same PDB: d2axua2, d2axub2, d2axuc2, d2axud2, d2axue2, d2axuf2, d2axug2, d2axuh2, d2axui2, d2axuj2, d2axuk2, d2axul2
    automatically matched to 2AW6 A:1-69

Details for d2axuk1

PDB Entry: 2axu (more details), 2.9 Å

PDB Description: Structure of PrgX
PDB Compounds: (K:) PrgX

SCOP Domain Sequences for d2axuk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axuk1 a.35.1.11 (K:4-68) PrgX {Enterococcus faecalis [TaxId: 1351]}
igsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeiln
ragmn

SCOP Domain Coordinates for d2axuk1:

Click to download the PDB-style file with coordinates for d2axuk1.
(The format of our PDB-style files is described here.)

Timeline for d2axuk1: