Lineage for d2axtv_ (2axt V:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980707Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1981148Protein automated matches [190113] (17 species)
    not a true protein
  7. 1981209Species Thermosynechococcus elongatus [TaxId:32046] [188751] (3 PDB entries)
  8. 1981210Domain d2axtv_: 2axt V: [127499]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtz1
    automated match to d3bz2v_
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtv_

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (V:) cytochrome c-550

SCOPe Domain Sequences for d2axtv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtv_ a.3.1.1 (V:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d2axtv_:

Click to download the PDB-style file with coordinates for d2axtv_.
(The format of our PDB-style files is described here.)

Timeline for d2axtv_: