Lineage for d2axhb2 (2axh B:119-244)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 656668Protein T-cell antigen receptor [49125] (6 species)
  7. 656679Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (16 PDB entries)
  8. 656689Domain d2axhb2: 2axh B:119-244 [127493]
    Other proteins in same PDB: d2axha1, d2axhb1
    automatically matched to d1ogae2
    mutant

Details for d2axhb2

PDB Entry: 2axh (more details), 2.7 Å

PDB Description: Crystal structures of T cell receptor beta chains related to rheumatoid arthritis
PDB Compounds: (B:) T cell receptor beta chain

SCOP Domain Sequences for d2axhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axhb2 b.1.1.2 (B:119-244) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgrad

SCOP Domain Coordinates for d2axhb2:

Click to download the PDB-style file with coordinates for d2axhb2.
(The format of our PDB-style files is described here.)

Timeline for d2axhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2axhb1