![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein T-cell antigen receptor [49125] (6 species) |
![]() | Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (16 PDB entries) |
![]() | Domain d2axha2: 2axh A:119-244 [127491] Other proteins in same PDB: d2axha1, d2axhb1 automatically matched to d1ogae2 mutant |
PDB Entry: 2axh (more details), 2.7 Å
SCOP Domain Sequences for d2axha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axha2 b.1.1.2 (A:119-244) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae awgrad
Timeline for d2axha2: