SCOP 1.73: Domain d2axfa1: 2axf A:182-276

Lineage for d2axfa1 (2axf A:182-276)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)

8. Domain d2axfa1: 2axf A:182-276 [127484]
   Other proteins in same PDB: d2axfa2, d2axfb1
   automatically matched to d1a1ma1
   complexed with acy

Details for d2axfa1

PDB Entry: 2axf, 1.8 Å

PDB Description: the immunogenicity of a viral cytotoxic t cell epitope is controlled by its mhc-bound conformation

PDB Compounds: (A:) HLA class I histocompatibility antigen, B*3508 heavy chain

SCOP Domain Sequences for d2axfa1:

Sequence; same for both SEQRES and ATOM records:

>d2axfa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

Timeline for d2axfa1:

• d2axfa1 is new in SCOP 1.73
  
• d2axfa1 appears in SCOP 1.75
  
• d2axfa1 appears in the current release, SCOPe 2.08