Lineage for d2axaa1 (2axa A:672-917)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 647847Protein Androgen receptor [63621] (3 species)
  7. 647857Species Human (Homo sapiens) [TaxId:9606] [63623] (15 PDB entries)
  8. 647862Domain d2axaa1: 2axa A:672-917 [127482]
    automatically matched to d1e3ga_
    complexed with fhm

Details for d2axaa1

PDB Entry: 2axa (more details), 1.8 Å

PDB Description: crystal structure of the androgen receptor ligand binding domain in complex with s-1
PDB Compounds: (A:) Androgen receptor

SCOP Domain Sequences for d2axaa1:

Sequence, based on SEQRES records: (download)

>d2axaa1 a.123.1.1 (A:672-917) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
dqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpts
csrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkv
kpiyfh

Sequence, based on observed residues (ATOM records): (download)

>d2axaa1 a.123.1.1 (A:672-917) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
dqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiacsrrfyql
tklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiyfh

SCOP Domain Coordinates for d2axaa1:

Click to download the PDB-style file with coordinates for d2axaa1.
(The format of our PDB-style files is described here.)

Timeline for d2axaa1: