SCOP 1.73: Domain d2awna1: 2awn A:236-370

Lineage for d2awna1 (2awn A:236-370)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.40: OB-fold [50198] (12 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.6: MOP-like [50331] (3 families)
Family b.40.6.3: ABC-transporter additional domain [50338] (3 proteins)
probably stems out from the biMOP domain
Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
Species Escherichia coli [TaxId:562] [101772] (5 PDB entries)
Domain d2awna1: 2awn A:236-370 [127459]
Other proteins in same PDB: d2awna2, d2awnb2, d2awnc2, d2awnd2
automatically matched to d1q12a1
complexed with adp, mg

Details for d2awna1

PDB Entry: 2awn (more details), 2.3 Å

PDB Description: Crystal structure of the ADP-Mg-bound E. Coli MALK (Crystallized with ATP-Mg)

PDB Compounds: (A:) Maltose/maltodextrin import ATP-binding protein malK

SCOP Domain Sequences for d2awna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awna1 b.40.6.3 (A:236-370) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepg

SCOP Domain Coordinates for d2awna1:

Click to download the PDB-style file with coordinates for d2awna1.
(The format of our PDB-style files is described here.)

Timeline for d2awna1: