Lineage for d2awfa1 (2awf A:7-131)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021591Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1021592Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1021593Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1021601Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1021639Species Human (Homo sapiens), E2 G1 [TaxId:9606] [143056] (1 PDB entry)
    Uniprot P62253 7-131
  8. 1021640Domain d2awfa1: 2awf A:7-131 [127432]

Details for d2awfa1

PDB Entry: 2awf (more details), 2.1 Å

PDB Description: Structure of human Ubiquitin-conjugating enzyme E2 G1
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 G1

SCOPe Domain Sequences for d2awfa1:

Sequence, based on SEQRES records: (download)

>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]}
slllrrqlaelnknpvegfsagliddndlyrwevliigppdtlyeggvfkahltfpkdyp
lrppkmkfiteiwhpnvdkngdvcisilhepgedkygyekpeerwlpihtvetimisvis
mladp

Sequence, based on observed residues (ATOM records): (download)

>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]}
slllrrqlaelnknpvegfsagliddndlyrwevliigppdtlyeggvfkahltfpkdyp
lrppkmkfiteiwhpnvdkngdvcisilheppeerwlpihtvetimisvismladp

SCOPe Domain Coordinates for d2awfa1:

Click to download the PDB-style file with coordinates for d2awfa1.
(The format of our PDB-style files is described here.)

Timeline for d2awfa1: