SCOP 1.75: Domain d2aw6a1: 2aw6 A:1-69

Lineage for d2aw6a1 (2aw6 A:1-69)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
   Part of Pfam PF01381

6. Protein PrgX [140527] (1 species)
   possibly involved in pheromone-inducible conjugation

7. Species Enterococcus faecalis [TaxId:1351] [140528] (7 PDB entries)
   Uniprot Q04114 1-69! Uniprot Q04114 2-66

8. Domain d2aw6a1: 2aw6 A:1-69 [127408]
   Other proteins in same PDB: d2aw6a2, d2aw6b2

Details for d2aw6a1

PDB Entry: 2aw6, 3 Å

PDB Description: structure of a bacterial peptide pheromone/receptor complex and its mechanism of gene regulation

PDB Compounds: (A:) PrgX

SCOP Domain Sequences for d2aw6a1:

Sequence; same for both SEQRES and ATOM records:

>d2aw6a1 a.35.1.11 (A:1-69) PrgX {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnragmnt

Timeline for d2aw6a1:

• d2aw6a1 first appeared in SCOP 1.73
  
• d2aw6a1 appears in SCOPe 2.01
  
• d2aw6a1 appears in the current release, SCOPe 2.08