Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries) Uniprot P01892 25-298 |
Domain d2av7d2: 2av7 D:1-181 [127363] Other proteins in same PDB: d2av7a1, d2av7b_, d2av7d1, d2av7e_ automatically matched to d1akja2 complexed with gol; mutant |
PDB Entry: 2av7 (more details), 2.05 Å
SCOPe Domain Sequences for d2av7d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2av7d2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetravkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d2av7d2:
View in 3D Domains from other chains: (mouse over for more information) d2av7a1, d2av7a2, d2av7b_, d2av7e_ |