SCOP 1.75: Domain d2av7d2: 2av7 D:1-181

Lineage for d2av7d2 (2av7 D:1-181)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries)
   Uniprot P01892 25-298

8. Domain d2av7d2: 2av7 D:1-181 [127363]
   Other proteins in same PDB: d2av7a1, d2av7b1, d2av7d1, d2av7e1
   automatically matched to d1akja2
   complexed with gol; mutant

Details for d2av7d2

PDB Entry: 2av7, 2.05 Å

PDB Description: crystal structure of htlv-1 tax peptide bound to human class i mhc hla-a2 with the k66a mutation in the heavy chain.

PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOP Domain Sequences for d2av7d2:

Sequence; same for both SEQRES and ATOM records:

>d2av7d2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetravkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d2av7d2:

• d2av7d2 first appeared in SCOP 1.73
  
• d2av7d2 appears in SCOPe 2.01
  
• d2av7d2 appears in the current release, SCOPe 2.08