Lineage for d2av3b1 (2av3 B:2-146)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758486Protein Hemoglobin I [46464] (2 species)
  7. 758487Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (17 PDB entries)
  8. 758503Domain d2av3b1: 2av3 B:2-146 [127356]
    automatically matched to d2hbia_
    complexed with hem; mutant

Details for d2av3b1

PDB Entry: 2av3 (more details), 1.7 Å

PDB Description: f97l- no ligand
PDB Compounds: (B:) Globin I

SCOP Domain Sequences for d2av3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2av3b1 a.1.1.2 (B:2-146) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvveklavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOP Domain Coordinates for d2av3b1:

Click to download the PDB-style file with coordinates for d2av3b1.
(The format of our PDB-style files is described here.)

Timeline for d2av3b1: