SCOPe 2.06: Domain d2av1a1: 2av1 A:182-275

Lineage for d2av1a1 (2av1 A:182-275)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (199 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d2av1a1: 2av1 A:182-275 [127349]
   Other proteins in same PDB: d2av1a2, d2av1b2, d2av1b3, d2av1d2, d2av1e2, d2av1e3
   automatically matched to d1akja1
   complexed with gol, scn; mutant

Details for d2av1a1

PDB Entry: 2av1, 1.95 Å

PDB Description: crystal structure of htlv-1 tax peptide bound to human class i mhc hla-a2 with the e63q and k66a mutations in the heavy chain.

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2av1a1:

Sequence; same for both SEQRES and ATOM records:

>d2av1a1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d2av1a1:

• d2av1a1 first appeared in SCOP 1.73
  
• d2av1a1 appears in SCOPe 2.05
  
• d2av1a1 appears in SCOPe 2.07
  
• d2av1a1 appears in the current release, SCOPe 2.08