Lineage for d2auha1 (2auh A:987-1283)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043032Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 1043033Species Human (Homo sapiens) [TaxId:9606] [56163] (15 PDB entries)
  8. 1043051Domain d2auha1: 2auh A:987-1283 [127329]
    automatically matched to d1rqqa_
    complexed with ca

Details for d2auha1

PDB Entry: 2auh (more details), 3.2 Å

PDB Description: crystal structure of the grb14 bps region in complex with the insulin receptor tyrosine kinase
PDB Compounds: (A:) Insulin receptor

SCOPe Domain Sequences for d2auha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2auha1 d.144.1.7 (A:987-1283) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk

SCOPe Domain Coordinates for d2auha1:

Click to download the PDB-style file with coordinates for d2auha1.
(The format of our PDB-style files is described here.)

Timeline for d2auha1: