Lineage for d2atwc2 (2atw C:184-262)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860188Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 860215Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 860216Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 860296Protein Transcription factor NusA, C-terminal domains [69701] (2 species)
    duplication: tandem repeat of two type II KH-domains
  7. 860297Species Mycobacterium tuberculosis [TaxId:1773] [69703] (3 PDB entries)
  8. 860306Domain d2atwc2: 2atw C:184-262 [127313]
    Other proteins in same PDB: d2atwa1, d2atwc1
    automatically matched to d1k0ra2

Details for d2atwc2

PDB Entry: 2atw (more details), 2.25 Å

PDB Description: Structure of a Mycobacterium tuberculosis NusA-RNA complex
PDB Compounds: (C:) Transcription elongation protein nusA

SCOP Domain Sequences for d2atwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atwc2 d.52.3.1 (C:184-262) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]}
thpnlvrklfslevpeiadgsveivavareaghrskiavrsnvaglnakgacigpmgqrv
rnvmselsgekidiidydd

SCOP Domain Coordinates for d2atwc2:

Click to download the PDB-style file with coordinates for d2atwc2.
(The format of our PDB-style files is described here.)

Timeline for d2atwc2: