Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
Protein S1 domain of NusA [69265] (2 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [69267] (3 PDB entries) |
Domain d2atwa1: 2atw A:108-183 [127309] Other proteins in same PDB: d2atwa2, d2atwa3, d2atwc2, d2atwc3 automatically matched to d1k0ra1 protein/RNA complex |
PDB Entry: 2atw (more details), 2.25 Å
SCOPe Domain Sequences for d2atwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atwa1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} stregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgnrlrcyv vgvtrgareplitlsr
Timeline for d2atwa1: