Lineage for d2atwa1 (2atw A:108-183)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399715Protein S1 domain of NusA [69265] (2 species)
  7. 2399716Species Mycobacterium tuberculosis [TaxId:1773] [69267] (3 PDB entries)
  8. 2399720Domain d2atwa1: 2atw A:108-183 [127309]
    Other proteins in same PDB: d2atwa2, d2atwa3, d2atwc2, d2atwc3
    automatically matched to d1k0ra1
    protein/RNA complex

Details for d2atwa1

PDB Entry: 2atw (more details), 2.25 Å

PDB Description: Structure of a Mycobacterium tuberculosis NusA-RNA complex
PDB Compounds: (A:) Transcription elongation protein nusA

SCOPe Domain Sequences for d2atwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atwa1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]}
stregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgnrlrcyv
vgvtrgareplitlsr

SCOPe Domain Coordinates for d2atwa1:

Click to download the PDB-style file with coordinates for d2atwa1.
(The format of our PDB-style files is described here.)

Timeline for d2atwa1: