Lineage for d2atqa2 (2atq A:376-903)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1234135Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1234136Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1234137Family e.8.1.1: DNA polymerase I [56673] (4 proteins)
  6. 1234214Protein Family B DNA polymerase [56680] (7 species)
  7. 1234215Species Bacteriophage RB69 [TaxId:12353] [56681] (15 PDB entries)
  8. 1234246Domain d2atqa2: 2atq A:376-903 [127304]
    Other proteins in same PDB: d2atqa1, d2atqb1
    automatically matched to d1clqa2
    protein/DNA complex; complexed with gdp, zn

Details for d2atqa2

PDB Entry: 2atq (more details), 3.2 Å

PDB Description: rb69 single-stranded dna binding protein-dna polymerase fusion
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d2atqa2:

Sequence, based on SEQRES records: (download)

>d2atqa2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf

Sequence, based on observed residues (ATOM records): (download)

>d2atqa2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakpsgte
itdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf

SCOPe Domain Coordinates for d2atqa2:

Click to download the PDB-style file with coordinates for d2atqa2.
(The format of our PDB-style files is described here.)

Timeline for d2atqa2:

Domains from same chain:
(mouse over for more information)
d2atqa1
Domains from other chains:
(mouse over for more information)
d2atqb1