SCOPe 2.02: Domain d2atpc_: 2atp C:

Lineage for d2atpc_ (2atp C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD8 [48734] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48736] (5 PDB entries)

8. Domain d2atpc_: 2atp C: [127302]
   automated match to d1bqhh_
   complexed with nag

Details for d2atpc_

PDB Entry: 2atp, 2.4 Å

PDB Description: crystal structure of a cd8ab heterodimer

PDB Compounds: (C:) T-cell surface glycoprotein CD8 alpha chain

SCOPe Domain Sequences for d2atpc_:

Sequence; same for both SEQRES and ATOM records:

>d2atpc_ b.1.1.1 (C:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkv

Timeline for d2atpc_:

• d2atpc_ first appeared in SCOP 1.73, called d2atpc1
  
• d2atpc_ appears in SCOPe 2.01
  
• d2atpc_ appears in SCOPe 2.03
  
• d2atpc_ appears in the current release, SCOPe 2.08