Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) |
Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins) |
Protein DinB homolog (DBH) [100881] (3 species) |
Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (50 PDB entries) |
Domain d2atlb1: 2atl B:1241-1341 [127298] Other proteins in same PDB: d2atla2, d2atlb2 automatically matched to d1n48a1 complexed with ca, dcp, ddg |
PDB Entry: 2atl (more details), 2.8 Å
SCOP Domain Sequences for d2atlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atlb1 d.240.1.1 (B:1241-1341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]} vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr tfphgisketaysesvkllqkileederkirrigvrfskfi
Timeline for d2atlb1: