Lineage for d2atkc_ (2atk C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252668Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2252669Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2252670Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2252772Protein automated matches [190184] (3 species)
    not a true protein
  7. 2252781Species Streptomyces lividans [TaxId:1916] [186922] (14 PDB entries)
  8. 2252786Domain d2atkc_: 2atk C: [127295]
    Other proteins in same PDB: d2atka1, d2atka2, d2atkb1, d2atkb2
    automated match to d2p7tc_
    complexed with f09, k; mutant

Details for d2atkc_

PDB Entry: 2atk (more details), 2.5 Å

PDB Description: structure of a mutant kcsa k+ channel
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2atkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atkc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvatattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d2atkc_:

Click to download the PDB-style file with coordinates for d2atkc_.
(The format of our PDB-style files is described here.)

Timeline for d2atkc_: